TA331633 SMCR7 antibody

Rabbit Polyclonal Anti-SMCR7 Antibody

See related secondary antibodies

Search for all "SMCR7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Guinea Pig, Human, Rat SMCR7

Product Description for SMCR7

Rabbit anti Equine, Guinea Pig, Human, Rat SMCR7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SMCR7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Smith-Magenis syndrome chromosomal region candidate gene 7 protein
Presentation Purified
Reactivity Eq, GP, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96C03
Immunogen:
The immunogen for Anti-SMCR7 Antibody is: synthetic peptide directed towards the N-terminal region of Human SMCR7. Synthetic peptide located within the following region: FSQKRGKRRSDEGLGSMVDFLLANARLVLGVGGAAVLGIATLAVKRFIDR.
GeneID:
125170
Application WB
Background This gene encodes an outer mitochondrial membrane protein that functions in the regulation of mitochondrial morphology. It can directly recruit the fission mediator dymin-related protein 1 (Drp1) to the mitochondrial surface. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SMCR7 (3 products)

Catalog No. Species Pres. Purity   Source  

SMCR7 (transcript variant 1)

SMCR7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SMCR7

SMCR7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SMCR7

SMCR7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SMCR7 (1 products)

Catalog No. Species Pres. Purity   Source  

MIEF2 overexpression lysate

MIEF2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn