TA331652 CCDC12 antibody

Rabbit Polyclonal Anti-CCDC12 Antibody

See related secondary antibodies

Search for all "CCDC12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CCDC12

Product Description for CCDC12

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CCDC12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 12
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUD4
Immunogen:
The immunogen for Anti-CCDC12 Antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC12. Synthetic peptide located within the following region: EQLEAAKPEPVIEEVDLANLAPRKPDWDLKRDVAKKLEKLKKRTQRAIAE.
GeneID:
151903
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC12 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC12

CCDC12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCDC12

CCDC12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CCDC12 (1 products)

Catalog No. Species Pres. Purity   Source  

CCDC12 Lysate

CCDC12 Lysate
  Novus Biologicals Inc.
  • LinkedIn