TA331657 PPTC7 antibody

Rabbit Polyclonal Anti-PPTC7 Antibody

See related secondary antibodies

Search for all "PPTC7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PPTC7

Product Description for PPTC7

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish PPTC7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPTC7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein phosphatase PTC7 homolog, T-cell activation protein phosphatase 2C, T-cell activation protein phosphatase 2C-like, TA-PP2C, TAPP2C
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NI37
Immunogen:
The immunogen for Anti-PPTC7 Antibody is: synthetic peptide directed towards the C-terminal region of Human PPTC7. Synthetic peptide located within the following region: PDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACD.
GeneID:
160760
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPTC7 (1 products)

Catalog No. Species Pres. Purity   Source  

PPTC7 (full length, N-term HIS tag)

PPTC7 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for PPTC7 (1 products)

Catalog No. Species Pres. Purity   Source  

PPTC7 overexpression lysate

PPTC7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn