TA331671 ASB14 antibody

Rabbit Polyclonal Anti-ASB14 Antibody

See related secondary antibodies

Search for all "ASB14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASB14

Product Description for ASB14

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASB14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASB14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ankyrin repeat and SOCS box protein 14
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NK59
Immunogen:
The immunogen for Anti-ASB14 Antibody is: synthetic peptide directed towards the N-terminal region of Human ASB14. Synthetic peptide located within the following region: LELLIQAGFDVNFMLDQRINKHYDDHRKSALYFAVSNSDLSSVKLLLSAG.
GeneID:
142686
Application WB
Background The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine siglling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Altertive splicing results in multiple transcript variants encoding different isoforms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ASB14 (1 products)

Catalog No. Species Pres. Purity   Source  

ASB14 overexpression lysate

ASB14 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn