TA331675 SP110 antibody

Rabbit Polyclonal Anti-SP110 Antibody

See related secondary antibodies

Search for all "SP110"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human SP110

Product Description for SP110

Rabbit anti Equine, Human SP110.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SP110

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ22835, IPR1, SP-110, SP110 nuclear body protein, Speckled 110 kD, VODI
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HB58
Immunogen:
The immunogen for Anti-SP110 Antibody: synthetic peptide directed towards the middle region of human SP110. Synthetic peptide located within the following region: LKAYCHPQSSFFTGIPFNIRDYGEPFQEAMWLDLVKERLITEMYTVAWFV.
GeneID:
3431
Application WB
Background The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. SP110 is a member of the SP100/SP140 family of nuclear body proteins and is a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Altertive splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SP110 (2 products)

Catalog No. Species Pres. Purity   Source  

SP110

SP110 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SP110

SP110 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SP110 (5 products)

Catalog No. Species Pres. Purity   Source  

SP110 293T Cell Transient Overexpression Lysate(Denatured)

SP110 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SP110 Lysate

Western Blot: SP110 Lysate [NBL1-16357] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SP110
  Novus Biologicals Inc.

SP110 overexpression lysate

SP110 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SP110 overexpression lysate

SP110 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

SP110 overexpression lysate

SP110 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn