TA331696 C4orf17 antibody

Rabbit Polyclonal Anti-C4orf17 Antibody

See related secondary antibodies

Search for all "C4orf17"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human C4orf17

Product Description for C4orf17

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human C4orf17.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C4orf17

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q53FE4
Immunogen:
The immunogen for Anti-C4orf17 Antibody is: synthetic peptide directed towards the C-terminal region of Human C4orf17. Synthetic peptide located within the following region: VKSPPTVKLPPNFTAKSKVLTRDTEGDQPTRVSSQGSEENKEVPKEAEHK.
GeneID:
84103
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C4orf17 (1 products)

Catalog No. Species Pres. Purity   Source  

C4orf17

C4orf17 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for C4orf17 (2 products)

Catalog No. Species Pres. Purity   Source  

C4orf17 Lysate

Western Blot: C4orf17 Lysate [NBL1-08463] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C4orf17 Protein
  Novus Biologicals Inc.

C4orf17 overexpression lysate

C4orf17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn