TA331711 RSPH6A / RSHL1 antibody

Rabbit Polyclonal Anti-RSPH6A Antibody

See related secondary antibodies

Search for all "RSPH6A / RSHL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat RSPH6A / RSHL1

Product Description for RSPH6A / RSHL1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat RSPH6A / RSHL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RSPH6A / RSHL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Radial spoke head protein 6 homolog A, Radial spoke head-like protein 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0K4
Immunogen:
The immunogen for Anti-RSPH6A Antibody is: synthetic peptide directed towards the C-terminal region of Human RSPH6A. Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV.
GeneID:
81492
Application WB
Background The protein encoded by this gene is similar to a sea urchin radial spoke head protein. Radial spoke protein complexes form part of the axoneme of eukaryotic flagella and are located between the axoneme's outer ring of doublet microtubules and central pair of microtubules. In Chlamydomos, radial spoke proteins are thought to regulate the activity of dynein and the symmetry of flagellar bending patterns. This gene maps to a region of chromosome 19 that is linked to primary ciliary dyskinesia-2 (CILD2).
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RSPH6A / RSHL1 (3 products)

Catalog No. Species Pres. Purity   Source  

RSPH6A / RSHL1

RSPH6A / RSHL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RSPH6A / RSHL1

RSPH6A / RSHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RSPH6A / RSHL1

RSPH6A / RSHL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RSPH6A / RSHL1 (1 products)

Catalog No. Species Pres. Purity   Source  

RSPH6A overexpression lysate

RSPH6A overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn