TA331723 TTI2 antibody

Rabbit Polyclonal Anti-TTI2 Antibody

See related secondary antibodies

Search for all "TTI2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit TTI2

Product Description for TTI2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit TTI2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TTI2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C8orf41, TELO2-interacting protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NXR4
Immunogen:
The immunogen for Anti-TTI2 Antibody is: synthetic peptide directed towards the N-terminal region of Human TTI2. Synthetic peptide located within the following region: THSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSV.
GeneID:
80185
Application WB
Background TTI2 is a regulator of the D damage response (DDR). 'TTI2 is part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kise-related protein kise (PIKK) family proteins. The TTT complex is involved in the cellular resistance to D damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). 'TTI2, together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TTI2 (1 products)

Catalog No. Species Pres. Purity   Source  

TTI2 (transcript variant 2)

TTI2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TTI2 (4 products)

Catalog No. Species Pres. Purity   Source  

C8orf41 Lysate

Western Blot: C8orf41 Lysate [NBL1-08569] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C8orf41
  Novus Biologicals Inc.

TTI2 overexpression lysate

TTI2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

TTI2 overexpression lysate

TTI2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

TTI2 overexpression lysate

TTI2 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn