TA331725 GPR157 antibody

Rabbit Polyclonal Anti-GPR157 Antibody

See related secondary antibodies

Search for all "GPR157"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GPR157

Product Description for GPR157

Rabbit anti Human GPR157.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR157

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 157
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5UAW9
Immunogen:
The immunogen for Anti-GPR157 Antibody is: synthetic peptide directed towards the C-terminal region of Human GPR157. Synthetic peptide located within the following region: VRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST.
GeneID:
80045
Application WB
Background GPR157 is a orphan receptor.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPR157 (3 products)

Catalog No. Species Pres. Purity   Source  

GPR157

GPR157 Human
  Abnova Taiwan Corp.

GPR157

GPR157 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GPR157

GPR157 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GPR157 (1 products)

Catalog No. Species Pres. Purity   Source  

GPR157 overexpression lysate

GPR157 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn