TA331735 HHIPL2 / HHIP3 antibody

Rabbit Polyclonal Anti-HHIPL2 Antibody

See related secondary antibodies

Search for all "HHIPL2 / HHIP3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human HHIPL2 / HHIP3

Product Description for HHIPL2 / HHIP3

Rabbit anti Human HHIPL2 / HHIP3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HHIPL2 / HHIP3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HHIP-like protein 2, KIAA1822L
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWX4
Immunogen:
The immunogen for Anti-HHIPL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human HHIPL2. Synthetic peptide located within the following region: SKNTLRGPGTKKKARVGPHVRQGKRRKSLKSHSGRMRPSAEQKRAGRSLP.
GeneID:
79802
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for HHIPL2 / HHIP3 (1 products)

Catalog No. Species Pres. Purity   Source  

HHIPL2 overexpression lysate

HHIPL2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn