TA331739 RanBP4 / Importin-4 antibody

Rabbit Polyclonal Anti-IPO4 Antibody

See related secondary antibodies

Search for all "RanBP4 / Importin-4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat RanBP4 / Importin-4

Product Description for RanBP4 / Importin-4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat RanBP4 / Importin-4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RanBP4 / Importin-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IMP4, IMP4B, IPO4, Importin-4b, Ran-binding protein 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TEX9
Immunogen:
The immunogen for Anti-IPO4 Antibody is: synthetic peptide directed towards the middle region of Human IPO4. Synthetic peptide located within the following region: NLGPKVQPYLPELMECMLQLLRNPSSPRAKELAVSALGAIATAAQASLLP.
GeneID:
79711
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RanBP4 / Importin-4 (1 products)

Catalog No. Species Pres. Purity   Source  

RanBP4 / Importin-4

RanBP4 / Importin-4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.
  • LinkedIn