TA331752 FASTKD3 antibody

Rabbit Polyclonal Anti-FASTKD3 Antibody

See related secondary antibodies

Search for all "FASTKD3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FASTKD3

Product Description for FASTKD3

Rabbit anti Human FASTKD3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FASTKD3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FAST kinase domain-containing protein 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14CZ7
Immunogen:
The immunogen for Anti-FASTKD3 Antibody is: synthetic peptide directed towards the N-terminal region of Human FASTKD3. Synthetic peptide located within the following region: HPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTME.
GeneID:
79072
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn