TA331764 PRAMEF1 antibody

Rabbit Polyclonal Anti-PRAMEF1 Antibody

See related secondary antibodies

Search for all "PRAMEF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRAMEF1

Product Description for PRAMEF1

Rabbit anti Human PRAMEF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRAMEF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRAME family member 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95521
Immunogen:
The immunogen for Anti-PRAMEF1 Antibody is: synthetic peptide directed towards the N-terminal region of Human PRAMEF1. Synthetic peptide located within the following region: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL.
GeneID:
65121
Application WB
Background This gene is a member of the PRAME (preferentially expressed antigen of melanoma) gene family which is expressed in many cancers but may function in reproductive tissues during development.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn