TA331765 Vasculin antibody

Rabbit Polyclonal Anti-DKFZP761C169 Antibody

See related secondary antibodies

Search for all "Vasculin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat Vasculin

TA331765

More Views

  • TA331765

Product Description for Vasculin

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat Vasculin.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Vasculin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GC-rich promoter-binding protein 1, GPBP, GPBP1, SSH6, Vascular wall-linked protein
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86WP2
Immunogen:
The immunogen for anti-Vasculinantibody: synthetic peptide directed towards the N terminal of human Vasculin
AA Sequence:
RKEKNGWRTHGRNGTENINHRGGYHGGSSRSRSSIFHAGKSQGLHENNIP
GeneID:
65056
Application Western blotting (0.2 - 1.0 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background Vasculin is a novel vascular protein differentially expressed in human atherogenesis. It functions as a GC-rich promoter-specific transactivating transcription factor and interacts with GTF2B, GTF2F2, RNA polymerase II and TBP. Widely expressed.
General Readings Hsu,L.C., et al., (2003) Kidd,V.J., Mol. Cell. Biol. 23 (23), 8773-8785
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Bovine, Dog, Chicken
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for Vasculin (1 products)

Catalog No. Species Pres. Purity   Source  

Vasculin (transcript variant 1)

Vasculin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Vasculin (3 products)

Catalog No. Species Pres. Purity   Source  

GPBP1 overexpression lysate

GPBP1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

GPBP1 overexpression lysate

GPBP1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

GPBP1 overexpression lysate

GPBP1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn