TA331769 MESDC1 antibody

Rabbit Polyclonal Anti-MESDC1 Antibody

See related secondary antibodies

Search for all "MESDC1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat MESDC1

Product Description for MESDC1

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rat MESDC1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MESDC1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Mesoderm development candidate 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1K6
Immunogen:
The immunogen for Anti-MESDC1 Antibody is: synthetic peptide directed towards the N-terminal region of Human MESDC1. Synthetic peptide located within the following region: AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA.
GeneID:
59274
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MESDC1 (2 products)

Catalog No. Species Pres. Purity   Source  

MESDC1 (1-362, His-tag)

MESDC1 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

MESDC1 (1-362, His-tag)

MESDC1 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH
  • LinkedIn