TA331784 BACH2 antibody

Rabbit Polyclonal Anti-BACH2 Antibody

See related secondary antibodies

Search for all "BACH2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat BACH2

Product Description for BACH2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat BACH2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for BACH2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BTB and CNC homolog 2, Transcription regulator protein BACH2, basic leucine zipper transcription factor 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYV9
Immunogen:
The immunogen for Anti-BACH2 Antibody: synthetic peptide directed towards the middle region of human BACH2. Synthetic peptide located within the following region: TSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY.
GeneID:
60468
Application WB
Background BACH2 belongs to the bZIP family. It is a transcriptiol regulator that acts as repressor or activator. The protein binds to Maf recognition elements (MARE) and play important roles in coorditing transcription activation and repression by MAFK.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for BACH2 (3 products)

Catalog No. Species Pres. Purity   Source  

BACH2

BACH2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

BACH2

BACH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

BACH2

BACH2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for BACH2 (2 products)

Catalog No. Species Pres. Purity   Source  

BACH2 Lysate

Western Blot: BACH2 Lysate [NBL1-07899] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for BACH2 Protein
  Novus Biologicals Inc.

BACH2 overexpression lysate

BACH2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn