TA331797 GATAD1 / ODAG antibody

Rabbit Polyclonal Anti-GATAD1 Antibody

See related secondary antibodies

Search for all "GATAD1 / ODAG"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog GATAD1 / ODAG

Product Description for GATAD1 / ODAG

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog GATAD1 / ODAG.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for GATAD1 / ODAG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GATA zinc finger domain-containing protein 1, Ocular development-associated gene protein
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WUU5
Immunogen:
The immunogen for anti-GATAD1 antibody: synthetic peptide directed towards the C terminal of human GATAD1.
AA Sequence:
KMEYLEFVCHAPSEYFKSRSSPFPTVPTRPEKGYIWTHVGPTPAITIKES
GeneID:
57798
Application Western blotting (0.2 - 1.0 µg/ml)
Background ODAG (Ocular development-associated gene) also called GATAD1, a novel transcription factor located on chromosome 7, encodes a protein that may play a role in eye development. mRNA profiling in multiple human tissue indicates that ODAG is expressed in human CD56+ NK cells and thyroid tissue.
General Readings Tsuruga,T., et al., (2002) Gene 290 (1-2), 125-130
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, African clawed frog, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for GATAD1 / ODAG (5 products)

Catalog No. Species Pres. Purity   Source  

GATAD1 / ODAG (full length, N-term HIS tag)

GATAD1 / ODAG Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

GATAD1 / ODAG

GATAD1 / ODAG Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GATAD1 / ODAG

GATAD1 / ODAG Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

GATAD1 / ODAG

GATAD1 / ODAG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GATAD1 / ODAG

GATAD1 / ODAG Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GATAD1 / ODAG (2 products)

Catalog No. Species Pres. Purity   Source  

GATAD1 overexpression lysate

GATAD1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Ocular development associated gene Lysate

Western Blot: Ocular development associated gene Lysate [NBL1-10985] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GATAD1
  Novus Biologicals Inc.
  • LinkedIn