TA331813 ZNF624 antibody

Rabbit Polyclonal Anti-ZNF624 Antibody

See related secondary antibodies

Search for all "ZNF624"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF624

Product Description for ZNF624

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF624.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF624

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1349, Zinc finger protein 624
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P2J8
Immunogen:
The immunogen for anti-ZNF624 antibody: synthetic peptide directed towards the middle region of human ZNF624.
AA Sequence:
PYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINYSCLTVHHR
GeneID:
57547
Application Western blotting (0.2 - 1.0 µg/ml)
Background ZNF624 belongs to the krueppel C2H2-type zinc-finger protein family, containing 21 C2H2-type zinc fingers and 1 KRAB domain. This protein, code by a gene located on chromosome 17, may be involved in transcriptional regulation.
General Readings Nagase,T., et al., (2000) DNA Res. 7 (1), 65-73
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Mouse, Rat, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF624 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF624

ZNF624 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF624

ZNF624 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn