discontinued

TA331831 RALGAPB antibody

Rabbit Polyclonal Anti-RALGAPB Antibody

See related secondary antibodies

Search for all "RALGAPB"

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RALGAPB

Product Description for RALGAPB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RALGAPB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RALGAPB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1219, Ral GTPase-activating protein subunit beta, p170
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86X10
Immunogen:
The immunogen for Anti-RALGAPB Antibody is: synthetic peptide directed towards the C-terminal region of Human RALGAPB. Synthetic peptide located within the following region: MKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVST.
GeneID:
57148
Application WB
Background RALGAPB is a non-catalytic subunit of the heterodimeric RalGAP1 and RalGAP2 complexes which act as GTPase activators for the Ras-like small GTPases RALA and RALB.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn