TA331894 SOX6 antibody

Rabbit Polyclonal Anti-SOX6 Antibody

See related secondary antibodies

Search for all "SOX6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SOX6

Product Description for SOX6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SOX6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SOX6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HSSOX6, SOXD, SRY (sex determining region Y)-box 6, SRY-box 6, Transcription factor SOX-6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35712
Immunogen:
The immunogen for Anti-SOX6 Antibody: synthetic peptide directed towards the middle region of human SOX6. Synthetic peptide located within the following region: YGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN.
GeneID:
55553
Application WB
Background SOX6 is a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved D-binding domain termed the high mobility group box and by their ability to bind the minor groove of D. SOX6 is a transcriptiol activator that is required for normal development of the central nervous system, chondrogenesis and maintence of cardiac and skeletal muscle cells. SOX6 interacts with other family members to cooperatively activate gene expression.Members of the SOX gene family, such as SOX6, encode transcription factors defined by the conserved high mobility group (HMG) D-binding domain. Unlike most transcription factors, SOX transcription factors bind to the minor groove of D, causing a 70- to 85-degree bend and introducing local conformatiol changes (Cohen-Barak et al., 2001 [PubMed 11255018]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2696 AL136780.1 1-2696 2697-5158 AC009869.7 10394-12855
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SOX6 (4 products)

Catalog No. Species Pres. Purity   Source  

SOX6 (transcript variant 1)

SOX6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SOX6 (transcript variant 2)

SOX6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SOX6

SOX6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SOX6

SOX6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SOX6 (3 products)

Catalog No. Species Pres. Purity   Source  

SOX6 293T Cell Transient Overexpression Lysate(Denatured)

SOX6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SOX6 Lysate

Western Blot: SOX6 Lysate [NBL1-16354] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SOX6
  Novus Biologicals Inc.

SOX6 overexpression lysate

SOX6 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn