TA331897 POLE3 antibody

Rabbit Polyclonal Anti-POLE3 Antibody

See related secondary antibodies

Search for all "POLE3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog POLE3

Product Description for POLE3

Rabbit anti Bovine, Canine, Human, Mouse, Rat, Zebrafish, African clawed frog POLE3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for POLE3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Arsenic-transactivated protein, CHRAC17, Chromatin accessibility complex 17, DNA polymerase II subunit 3, DNA polymerase epsilon subunit 3, DNA polymerase epsilon subunit p17
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Hu, Ms, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 17 kDa (147 amino acids)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRF9
Immunogen:
The immunogen for anti-POLE3 antibody: synthetic peptide directed towards the N terminal of human POLE3.
AA Sequence:
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS
GeneID:
54107
Application Western blotting (2-5 µg/ml).
Background POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
General Readings Bolognese,F., et al., (2000) Nucleic Acids Res. 28 (19), 3830-3838
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Affinity Chromatography on Protein A
Buffer System:
PBS
Preservatives:
0.09% (w/v) Sodium Azide
Stabilizers:
2% Sucrose
State:
Liquid purified IgG fraction
Aff - Purified
Reconstitution:
Add 100 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, African clawed frog, Bovine, Zebrafish
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for POLE3 (7 products)

Catalog No. Species Pres. Purity   Source  

POLE3

POLE3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLE3 (1-147, His-tag)

POLE3 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

POLE3 (1-147, His-tag)

POLE3 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

POLE3

POLE3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLE3

POLE3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLE3

POLE3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

POLE3

POLE3 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for POLE3 (2 products)

Catalog No. Species Pres. Purity   Source  

POLE3 293T Cell Transient Overexpression Lysate(Denatured)

POLE3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

POLE3 293T Cell Transient Overexpression Lysate(Denatured)

POLE3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn