TA331944 SUSD5 antibody

Rabbit Polyclonal Anti-SUSD5 Antibody

See related secondary antibodies

Search for all "SUSD5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Rat SUSD5

Product Description for SUSD5

Rabbit anti Equine, Human, Rat SUSD5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SUSD5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0527, Sushi domain-containing protein 5
Presentation Purified
Reactivity Eq, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60279
Immunogen:
The immunogen for Anti-SUSD5 Antibody is: synthetic peptide directed towards the middle region of Human SUSD5. Synthetic peptide located within the following region: PGLEKEVDDDTKKQFSAGDNHSGVKLVPGEPETKVIYGNTDGPSGPFVGK.
GeneID:
26032
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SUSD5 (2 products)

Catalog No. Species Pres. Purity   Source  

SUSD5

SUSD5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SUSD5

SUSD5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SUSD5 (1 products)

Catalog No. Species Pres. Purity   Source  

SUSD5 overexpression lysate

SUSD5 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn