TA331950 C20orf4 antibody

Rabbit Polyclonal Anti-AAR2 Antibody

See related secondary antibodies

Search for all "C20orf4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C20orf4

Product Description for C20orf4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat C20orf4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C20orf4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CGI-23, PRO0225, Uncharacterized protein C20orf4, chromosome 20 open reading frame 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y312
Immunogen:
The immunogen for Anti-AAR2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AAR2. Synthetic peptide located within the following region: KFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWST.
GeneID:
25980
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C20orf4 (3 products)

Catalog No. Species Pres. Purity   Source  

C20orf4

C20orf4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C20orf4

C20orf4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

C20orf4

C20orf4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for C20orf4 (3 products)

Catalog No. Species Pres. Purity   Source  

AAR2 overexpression lysate

AAR2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

C20orf4 293T Cell Transient Overexpression Lysate(Denatured)

C20orf4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C20orf4 Lysate

Western Blot: C20orf4 Lysate [NBL1-08374] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C20orf4 Protein
  Novus Biologicals Inc.
  • LinkedIn