TA331965 PMPCA antibody

Rabbit Polyclonal Anti-PMPCA Antibody

See related secondary antibodies

Search for all "PMPCA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PMPCA

Product Description for PMPCA

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat PMPCA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PMPCA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha-MPP, INPP5E, KIAA0123, MPPA, Mitochondrial-processing peptidase subunit alpha, P-55
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q10713
Immunogen:
The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP.
GeneID:
23203
Application WB
Background PMPCA cleaves presequences (transit peptides) from mitochondrial protein precursors.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PMPCA (3 products)

Catalog No. Species Pres. Purity   Source  

PMPCA

PMPCA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PMPCA

PMPCA Human Purified
  Abnova Taiwan Corp.

PMPCA

PMPCA Human Purified
  Abnova Taiwan Corp.

Positive controls for PMPCA (1 products)

Catalog No. Species Pres. Purity   Source  

PMPCA overexpression lysate

PMPCA overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn