TA331966 COLGALT2 antibody

Rabbit Polyclonal Anti-COLGALT2 Antibody

See related secondary antibodies

Search for all "COLGALT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat COLGALT2

Product Description for COLGALT2

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rat COLGALT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for COLGALT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C1orf17, Collagen beta(1-O)galactosyltransferase 2, GLT25D2, Glycosyltransferase 25 family member 2, Hydroxylysine galactosyltransferase 2, KIAA0584, Procollagen galactosyltransferase 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IYK4
Immunogen:
The immunogen for Anti-GLT25D2 Antibody is: synthetic peptide directed towards the C-terminal region of Human GLT25D2. Synthetic peptide located within the following region: YTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSRIYSNAKNTEAL.
GeneID:
23127
Application WB
Background GLT25D2 has a beta-galactosyltransferase activity and transfers beta-galactose to hydroxylysine residues on collagen.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn