TA331996 Arfaptin-2 antibody

Rabbit Polyclonal Anti-ARFIP2 Antibody

See related secondary antibodies

Search for all "Arfaptin-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Arfaptin-2

Product Description for Arfaptin-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep Arfaptin-2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Arfaptin-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ADP-ribosylation factor-interacting protein 2, ARFIP2, POR1, Partner of RAC1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P53365
Immunogen:
The immunogen for Anti-ARFIP2 Antibody: synthetic peptide directed towards the N terminal of human ARFIP2. Synthetic peptide located within the following region: PEDDGLEQDLQQVMVSGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHST.
GeneID:
23647
Application WB
Background ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Arfaptin-2 (9 products)

Catalog No. Species Pres. Purity   Source  

Arfaptin-2

Arfaptin-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Arfaptin-2 (1-341, His-tag)

Arfaptin-2 Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

Arfaptin-2 (1-341, His-tag)

Arfaptin-2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

Arfaptin-2

Arfaptin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Arfaptin-2

Arfaptin-2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Arfaptin-2

Arfaptin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Arfaptin-2

Arfaptin-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Arfaptin-2

Arfaptin-2 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Arfaptin-2

Arfaptin-2 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for Arfaptin-2 (2 products)

Catalog No. Species Pres. Purity   Source  

ARFIP2 293T Cell Transient Overexpression Lysate(Denatured)

ARFIP2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ARFIP2 Lysate

Western Blot: ARFIP2 Lysate [NBL1-07660] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARFIP2 Protein
  Novus Biologicals Inc.
  • LinkedIn