TA332000 ABCB10 antibody

Rabbit Polyclonal Anti-Abcb10 Antibody

See related secondary antibodies

Search for all "ABCB10"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ABCB10

Product Description for ABCB10

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish ABCB10.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ABCB10

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ATP-binding cassette sub-family B member 10 mitochondrial, M-ABC2, Mitochondrial ATP-binding cassette 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRK6
Immunogen:
The immunogen for Anti-Abcb10 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TRTGELINRLSSDTALLGHSVTENLSDGLRAVAQASVGVGMMFFVSPSLA.
GeneID:
23456
Application WB
Background Abcb10 may mediate critical mitochondrial transport functions related to heme biosynthesis.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ABCB10 (2 products)

Catalog No. Species Pres. Purity   Source  

ABCB10

ABCB10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ABCB10

ABCB10 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ABCB10 (1 products)

Catalog No. Species Pres. Purity   Source  

ABCB10 overexpression lysate

ABCB10 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn