TA332039 Zkscan8 antibody

Rabbit Polyclonal Anti-ZNF192 Antibody

See related secondary antibodies

Search for all "Zkscan8"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Porcine Zkscan8

Product Description for Zkscan8

Rabbit anti Bovine, Canine, Equine, Goat, Human, Porcine Zkscan8.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Zkscan8

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B2RX01, Zfp192
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15776
Immunogen:
The immunogen for Anti-ZNF192 Antibody: synthetic peptide directed towards the N terminal of human ZNF192. Synthetic peptide located within the following region: PSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ.
GeneID:
7745
Application WB
Background ZNF192 belongs to the krueppel C2H2-type zinc-finger protein family and contains the conserved SCAN box domain. ZNF192 may be involved in transcriptiol regulation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Zkscan8 (4 products)

Catalog No. Species Pres. Purity   Source  

Zkscan8

Zkscan8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Zkscan8

Zkscan8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Zkscan8

Zkscan8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Zkscan8

Zkscan8 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Zkscan8 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF192 293T Cell Transient Overexpression Lysate(Denatured)

ZNF192 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn