TA332048 PNMA1 / MA1 antibody

Rabbit Polyclonal Anti-PNMA1 Antibody

See related secondary antibodies

Search for all "PNMA1 / MA1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PNMA1 / MA1

Product Description for PNMA1 / MA1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PNMA1 / MA1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PNMA1 / MA1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 37 kDa neuronal protein, Neuron- and testis-specific protein 1, Paraneoplastic antigen Ma1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8ND90
Immunogen:
The immunogen for Anti-PNMA1 Antibody: synthetic peptide directed towards the middle region of human PNMA1. Synthetic peptide located within the following region: LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH.
GeneID:
9240
Application WB
Background PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PNMA1 / MA1 (5 products)

Catalog No. Species Pres. Purity   Source  

PNMA1 / MA1

PNMA1 / MA1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PNMA1 / MA1

PNMA1 / MA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PNMA1 / MA1

PNMA1 / MA1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

PNMA1 / MA1

PNMA1 / MA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PNMA1 / MA1

PNMA1 / MA1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PNMA1 / MA1 (3 products)

Catalog No. Species Pres. Purity   Source  

PNMA1 293T Cell Transient Overexpression Lysate(Denatured)

PNMA1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PNMA1 Lysate

Western Blot: PNMA1 Lysate [NBL1-14546] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PNMA1
  Novus Biologicals Inc.

PNMA1 overexpression lysate

PNMA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn