TA332101 RNASET2 antibody

Rabbit Polyclonal Anti-RNASET2 Antibody

See related secondary antibodies

Search for all "RNASET2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Rat RNASET2

TA332101

More Views

  • TA332101

Product Description for RNASET2

Rabbit anti Canine, Equine, Human, Rat RNASET2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNASET2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RNASE6PL, Ribonuclease 6, Ribonuclease T2
Presentation Purified
Reactivity Can, Eq, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00584
Immunogen:
The immunogen for Anti-RNASET2 Antibody: synthetic peptide directed towards the middle region of human RNASET2. Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI.
GeneID:
8635
Application WB
Background This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human maligncies and chromosomal rearrangement.This ribonuclease gene is a novel member of the Rh/T2/S-glycoprotein class of extracellular ribonucleases. It is a single copy gene that maps to 6q27, a region associated with human maligncies and chromosomal rearrangement. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordites used for the transcript record were based on alignments.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNASET2 (4 products)

Catalog No. Species Pres. Purity   Source  

RNASET2

RNASET2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RNASET2

RNASET2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNASET2

RNASET2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNASET2

RNASET2 Human Purified
  Novus Biologicals Inc.

Positive controls for RNASET2 (1 products)

Catalog No. Species Pres. Purity   Source  

RNASET2 293T Cell Transient Overexpression Lysate(Denatured)

RNASET2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn