TA332103 PIP4K2B / PIP5K2B antibody

Rabbit Polyclonal Anti-PIP4K2B Antibody

See related secondary antibodies

Search for all "PIP4K2B / PIP5K2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PIP4K2B / PIP5K2B

Product Description for PIP4K2B / PIP5K2B

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat PIP4K2B / PIP5K2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PIP4K2B / PIP5K2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Diphosphoinositide kinase 2-beta, PIP4KII-beta, Phosphatidylinositol-5-phosphate 4-kinase type-2 beta, PtdIns(5)P-4-kinase isoform 2-beta
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78356
Immunogen:
The immunogen for Anti-PIP4K2B Antibody is: synthetic peptide directed towards the C-terminal region of Human PIP4K2B. Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS.
GeneID:
8396
Application WB
Background The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate 4-kise family. The encoded protein sequence does not show similarity to other kises, but the protein does exhibit kise activity. Additiolly, the encoded protein interacts with p55 TNF receptor.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PIP4K2B / PIP5K2B (7 products)

Catalog No. Species Pres. Purity   Source  

PIP4K2B / PIP5K2B

PIP4K2B /  PIP5K2B Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PIP4K2B / PIP5K2B (1-416, His-tag)

PIP4K2B /  PIP5K2B Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

PIP4K2B / PIP5K2B (1-416, His-tag)

PIP4K2B /  PIP5K2B Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

PIP4K2B / PIP5K2B

PIP4K2B /  PIP5K2B Human in vitro transl.
  Abnova Taiwan Corp.

PIP4K2B / PIP5K2B

PIP4K2B /  PIP5K2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PIP4K2B / PIP5K2B

PIP4K2B /  PIP5K2B Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PIP4K2B / PIP5K2B

PIP4K2B /  PIP5K2B Human
  Abnova Taiwan Corp.

Positive controls for PIP4K2B / PIP5K2B (1 products)

Catalog No. Species Pres. Purity   Source  

PIP4K2B overexpression lysate

PIP4K2B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn