TA332170 FBXW12 antibody

Rabbit Polyclonal Anti-FBXW12 Antibody

See related secondary antibodies

Search for all "FBXW12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FBXW12

Product Description for FBXW12

Rabbit anti Human FBXW12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXW12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box and WD-40 domain-containing protein 12, F-box only protein 35, F-box/WD repeat-containing protein 12, FBW12, FBXO12, FBXO35
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6X9E4
Immunogen:
The immunogen for Anti-FBXW12 Antibody is: synthetic peptide directed towards the C-terminal region of Human FBXW12. Synthetic peptide located within the following region: CASACWTPKVKNRITLMSQSSTGKKTEFITFDLTTKKTGGQTVIQAYEIA.
GeneID:
285231
Application WB
Background Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitition targets through other protein interaction domains.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXW12 (4 products)

Catalog No. Species Pres. Purity   Source  

FBXW12

FBXW12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXW12

FBXW12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXW12

FBXW12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

FBXW12

FBXW12 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for FBXW12 (2 products)

Catalog No. Species Pres. Purity   Source  

FBXW12 293T Cell Transient Overexpression Lysate(Denatured)

FBXW12 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FBXW12 overexpression lysate

FBXW12 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn