TA332175 TMEM114 antibody

Rabbit Polyclonal Anti-TMEM114 Antibody

See related secondary antibodies

Search for all "TMEM114"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Porcine, Rat TMEM114

Product Description for TMEM114

Rabbit anti Bovine, Human, Mouse, Porcine, Rat TMEM114.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TMEM114

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transmembrane protein 114
Presentation Purified
Reactivity Bov, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3SHH9
Immunogen:
The immunogen for Anti-TMEM114 Antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM114. Synthetic peptide located within the following region: GPGAQDLLGSINRSQPEPLSSHSGLWRTCRVQSPCTPLMNPFRLENVTVS.
GeneID:
283953
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn