TA332183 ACOXL antibody

Rabbit Polyclonal Anti-ACOXL Antibody

See related secondary antibodies

Search for all "ACOXL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine, Rabbit ACOXL

Product Description for ACOXL

Rabbit anti Canine, Equine, Human, Porcine, Rabbit ACOXL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ACOXL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Acyl-coenzyme A oxidase-like protein
Presentation Purified
Reactivity Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NUZ1
Immunogen:
The immunogen for Anti-ACOXL Antibody is: synthetic peptide directed towards the C-terminal region of Human ACOXL. Synthetic peptide located within the following region: AQYTKQYEEKPLFGLLQNWAESVGDKLRTSFLAFNMDTVDDLAFLLKAVK.
GeneID:
55289
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn