TA332195 TDRD12 antibody

Rabbit Polyclonal Anti-TDRD12 Antibody

See related secondary antibodies

Search for all "TDRD12"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human, Porcine TDRD12

Product Description for TDRD12

Rabbit anti Bovine, Equine, Human, Porcine TDRD12.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TDRD12

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ECAT8, ES cell-associated transcript 8 protein, Putative ATP-dependent RNA helicase TDRD12, Tudor domain-containing protein 12
Presentation Purified
Reactivity Bov, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q587J7
Immunogen:
The immunogen for Anti-TDRD12 Antibody is: synthetic peptide directed towards the C-terminal region of Human TDRD12. Synthetic peptide located within the following region: DKAVKCNMDSLRDSPKDKSEKKHHCISLKDTNKRVESSVYWPAKRGITIY.
GeneID:
91646
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for TDRD12 (1 products)

Catalog No. Species Pres. Purity   Source  

TDRD12 overexpression lysate

TDRD12 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn