TA332224 FAM110C antibody

Rabbit Polyclonal Anti-FAM110C Antibody

See related secondary antibodies

Search for all "FAM110C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM110C

Product Description for FAM110C

Rabbit anti Human FAM110C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM110C

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q1W6H9
Immunogen:
The immunogen for Anti-FAM110C Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM110C. Synthetic peptide located within the following region: DSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAG.
GeneID:
642273
Application WB
Background FAM110C may play a role in microtubule organization.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM110C (1 products)

Catalog No. Species Pres. Purity   Source  

FAM110C overexpression lysate

FAM110C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn