TA332233 EFTUD1 antibody

Rabbit Polyclonal Anti-EFTUD1 Antibody

See related secondary antibodies

Search for all "EFTUD1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EFTUD1

Product Description for EFTUD1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat EFTUD1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for EFTUD1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EFL1, Elongation factor Tu GTP-binding domain-containing protein 1, Elongation factor-like 1, FAM42A, Protein FAM42A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z2Z2
Immunogen:
The immunogen for Anti-EFTUD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human EFTUD1. Synthetic peptide located within the following region: KVLEERAERETESQVNPNSEQGEQVYDWSTGLEDTDDSHLYFSPEQGNVV.
GeneID:
79631
Application WB
Background EFTUD1 is involved in the biogenesis of the 60S ribosomal subunit and translatiol activation of ribosomes. Together with SBDS, EFTUD1 triggers the GTP-dependent release of EIF6 from 60S pre-ribosomes in the cytoplasm, thereby activating ribosomes for translation competence by allowing 80S ribosome assembly and facilitating EIF6 recycling to the nucleus, where it is required for 60S rR processing and nuclear export. EFTUD1 has low intrinsic GTPase activity. GTPase activity is increased by contact with 60S ribosome subunits.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn