TA332240 TRIM71 antibody

Rabbit Polyclonal Anti-TRIM71 Antibody

See related secondary antibodies

Search for all "TRIM71"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TRIM71

Product Description for TRIM71

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish TRIM71.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM71

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LIN41, Protein lin-41 homolog, Tripartite motif-containing protein 71
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q2Q1W2
Immunogen:
The immunogen for Anti-TRIM71 Antibody is: synthetic peptide directed towards the C-terminal region of Human TRIM71. Synthetic peptide located within the following region: ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCK.
GeneID:
131405
Application WB
Background TRIM71 may be involved in controlling the timing of organ formation during development.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM71 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM71

TRIM71 Human
  Abnova Taiwan Corp.

TRIM71

TRIM71 Human
  Abnova Taiwan Corp.
  • LinkedIn