TA332265 DDX60L antibody

Rabbit Polyclonal Anti-DDX60L Antibody

See related secondary antibodies

Search for all "DDX60L"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human DDX60L

Product Description for DDX60L

Rabbit anti Equine, Human DDX60L.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DDX60L

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DEAD box protein 60-like, Probable ATP-dependent RNA helicase DDX60-like
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5H9U9
Immunogen:
The immunogen for Anti-DDX60L Antibody is: synthetic peptide directed towards the N-terminal region of Human DDX60L. Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW.
GeneID:
91351
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn