TA332277 FBXO47 antibody

Rabbit Polyclonal Anti-FBXO47 Antibody

See related secondary antibodies

Search for all "FBXO47"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Yeast FBXO47

Product Description for FBXO47

Rabbit anti Human, Yeast FBXO47.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FBXO47

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms F-box only protein 47
Presentation Purified
Reactivity Hu, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5MNV8
Immunogen:
The immunogen for Anti-FBXO47 Antibody is: synthetic peptide directed towards the N-terminal region of Human FBXO47. Synthetic peptide located within the following region: ASRINTNFTLIPNQKLRRSNRQTSCYSKTLGSGFQPISTFGNFKALPLEI.
GeneID:
494188
Application WB
Background FBXO47 probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitition and degradation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FBXO47 (2 products)

Catalog No. Species Pres. Purity   Source  

FBXO47

FBXO47 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FBXO47

FBXO47 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn