TA332288 Olfactory receptor 9Q1 antibody

Rabbit Polyclonal Anti-OR9Q1 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 9Q1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Rat Olfactory receptor 9Q1

Product Description for Olfactory receptor 9Q1

Rabbit anti Human, Rat Olfactory receptor 9Q1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 9Q1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OR9Q1
Presentation Purified
Reactivity Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NGQ5
Immunogen:
The immunogen for Anti-OR9Q1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9Q1. Synthetic peptide located within the following region: SQAKTFSTCTSHLTAVSLFFGTLIFMYLRGNSDQSSEKNRVVSVLYTEVI.
GeneID:
219956
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn