TA333309 ZDHHC24 antibody

Rabbit Polyclonal Anti-ZDHHC24 Antibody

See related secondary antibodies

Search for all "ZDHHC24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human ZDHHC24

Product Description for ZDHHC24

Rabbit anti Bovine, Canine, Human ZDHHC24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZDHHC24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DHHC-24, Probable palmitoyltransferase ZDHHC24, UNQ2528/PRO6027, Zinc finger DHHC domain-containing protein 24
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UX98
Immunogen:
The immunogen for Anti-ZDHHC24 Antibody: synthetic peptide directed towards the middle region of human ZDHHC24. Synthetic peptide located within the following region: QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA.
GeneID:
254359
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZDHHC24 (2 products)

Catalog No. Species Pres. Purity   Source  

ZDHHC24

ZDHHC24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZDHHC24

ZDHHC24 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZDHHC24 (1 products)

Catalog No. Species Pres. Purity   Source  

ZDHHC24 overexpression lysate

ZDHHC24 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn