TA333313 SPINK6 antibody

Rabbit Polyclonal Anti-SPINK6 Antibody

See related secondary antibodies

Search for all "SPINK6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Porcine SPINK6

Product Description for SPINK6

Rabbit anti Equine, Human, Porcine SPINK6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPINK6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Serine protease inhibitor Kazal-type 6
Presentation Purified
Reactivity Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6UWN8
Immunogen:
The immunogen for Anti-SPINK6 Antibody: synthetic peptide directed towards the middle region of human SPINK6. Synthetic peptide located within the following region: GEFQDPKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC.
GeneID:
404203
Application WB
Background The protein encoded by this gene is a Kazal-type serine protease inhibitor that acts on kallikrein-related peptidases in the skin. Two transcript variants the same protein have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SPINK6 (2 products)

Catalog No. Species Pres. Purity   Source  

SPINK6

SPINK6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SPINK6

SPINK6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SPINK6 (1 products)

Catalog No. Species Pres. Purity   Source  

SPINK6 overexpression lysate

SPINK6 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn