TA333314 APOBEC4 antibody

Rabbit Polyclonal Anti-APOBEC4 Antibody

See related secondary antibodies

Search for all "APOBEC4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human APOBEC4

Product Description for APOBEC4

Rabbit anti Canine, Human APOBEC4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for APOBEC4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms APOBEC-4, C1orf169, Putative C->U-editing enzyme APOBEC-4. Apolipoprotein B mRNA editing enzyme antibody, anti-catalytic polypeptide-like 4
Presentation Aff - Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8WW27
Immunogen:
Synthetic peptide directed towards the N terminal of human APOBEC4
AA Sequence:
LKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
GeneID:
403314
Application

Western blotting  (0.2 - 1 µg/ml).

Background APOBEC4 expressed mainly in testis is a putative C to U editing enzyme whose physiological substrate is not yet known.This gene encodes a member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases, which convert cytidine to uridine. Other AID/APOBEC family members are involved in mRNA editing, somatic hypermutation and recombination of immunoglobulin genes, and innate immunity to retroviral infection.
General Readings "APOBEC4, a new member of the AID/APOBEC family of polynucleotide (deoxy)cytidine deaminases predicted by computational analysis." Rogozin I.B., Basu M.K., Jordan I.K., Pavlov Y.I., Koonin E.V. Cell Cycle 4:1281-1285(2005)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Bovine, Guinea Pig
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for APOBEC4 (3 products)

Catalog No. Species Pres. Purity   Source  

APOBEC4 (N-term HIS tag)

APOBEC4 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

APOBEC4 (1-367, His-tag)

APOBEC4 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

APOBEC4 (1-367, His-tag)

APOBEC4 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH
  • LinkedIn