TA333320 LRRN4CL antibody

Rabbit Polyclonal Anti-LRRN4CL Antibody

See related secondary antibodies

Search for all "LRRN4CL"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human, Rat LRRN4CL

Product Description for LRRN4CL

Rabbit anti Equine, Human, Rat LRRN4CL.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LRRN4CL

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LRRN4 C-terminal-like protein
Presentation Purified
Reactivity Eq, Hu, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8ND94
Immunogen:
The immunogen for Anti-LRRN4CL Antibody: synthetic peptide directed towards the middle region of human LOC221091. Synthetic peptide located within the following region: PFSPVLHYWLLLWDGSEAAQKGPPLNATVRRAELKGLKPGGIYVVCVVAA.
GeneID:
221091
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LRRN4CL (3 products)

Catalog No. Species Pres. Purity   Source  

LRRN4CL

LRRN4CL Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

LRRN4CL

LRRN4CL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LRRN4CL

LRRN4CL Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for LRRN4CL (2 products)

Catalog No. Species Pres. Purity   Source  

LOC221091 293T Cell Transient Overexpression Lysate(Denatured)

LOC221091 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

LRRN4CL overexpression lysate

LRRN4CL overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn