TA333335 SPEM1 antibody

Rabbit Polyclonal Anti-SPEM1 Antibody

See related secondary antibodies

Search for all "SPEM1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human SPEM1

Product Description for SPEM1

Rabbit anti Human SPEM1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SPEM1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C17orf83, Spermatid maturation protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4L4
Immunogen:
The immunogen for Anti-SPEM1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SPEM1. Synthetic peptide located within the following region: KSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRC.
GeneID:
374768
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for SPEM1 (2 products)

Catalog No. Species Pres. Purity   Source  

SPEM1 Lysate

Western Blot: SPEM1 Lysate [NBL1-16392] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SPEM1
  Novus Biologicals Inc.

SPEM1 overexpression lysate

SPEM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn