TA333336 PRR19 antibody

Rabbit Polyclonal Anti-MGC70924 Antibody

See related secondary antibodies

Search for all "PRR19"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human PRR19

Product Description for PRR19

Rabbit anti Human PRR19.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PRR19

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms MGC70924, Proline-rich protein 19
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NJB7
Immunogen:
The immunogen for Anti-MGC70924 Antibody: synthetic peptide directed towards the N terminal of human MGC70924. Synthetic peptide located within the following region: MDTQGPVSQPFQQPEKPGRVRRRKTRRERNKALVGSRRPLAHHDPPVAIR.
GeneID:
284338
Application WB
Background The specific function of the protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for PRR19 (1 products)

Catalog No. Species Pres. Purity   Source  

PRR19 overexpression lysate

PRR19 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn