TA333341 NAPE-PLD antibody

Rabbit Polyclonal Anti-NAPEPLD Antibody

See related secondary antibodies

Search for all "NAPE-PLD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NAPE-PLD

Product Description for NAPE-PLD

Rabbit anti Human NAPE-PLD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NAPE-PLD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C7orf18, N-acyl phosphatidylethanolamine phospholipase D, N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D, NAPE-hydrolyzing phospholipase D, NAPEPLD
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IQ20
Immunogen:
The immunogen for Anti-NAPEPLD Antibody is: synthetic peptide directed towards the C-terminal region of HUMAN NAPEPLD. Synthetic peptide located within the following region: AFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKS.
GeneID:
222236
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NAPE-PLD (2 products)

Catalog No. Species Pres. Purity   Source  

NAPE-PLD (transcript variant 2)

NAPE-PLD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NAPE-PLD (transcript variant 1)

NAPE-PLD Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NAPE-PLD (3 products)

Catalog No. Species Pres. Purity   Source  

NAPE-PLD Lysate

Western Blot: NAPE-PLD Lysate [NBL1-13476] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NAPEPLD
  Novus Biologicals Inc.

NAPEPLD overexpression lysate

NAPEPLD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NAPEPLD overexpression lysate

NAPEPLD overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn