TA333362 NHLRC2 antibody

Rabbit Polyclonal Anti-NHLRC2 Antibody

See related secondary antibodies

Search for all "NHLRC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat NHLRC2

Product Description for NHLRC2

Rabbit anti Canine, Equine, Human, Mouse, Porcine, Rat NHLRC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NHLRC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NHL repeat-containing protein 2
Presentation Purified
Reactivity Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NBF2
Immunogen:
The immunogen for Anti-NHLRC2 Antibody: synthetic peptide directed towards the N terminal of human NHLRC2. Synthetic peptide located within the following region: YSDKDGLLIIGVHSAKFPNEKVLDNIKSAVLRYNITHPMVNDADASLWQE.
GeneID:
374354
Application WB
Background The specific function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NHLRC2 (2 products)

Catalog No. Species Pres. Purity   Source  

NHLRC2

NHLRC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NHLRC2

NHLRC2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NHLRC2 (1 products)

Catalog No. Species Pres. Purity   Source  

NHLRC2 293T Cell Transient Overexpression Lysate(Denatured)

NHLRC2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn