TA333377 C14orf166B antibody

Rabbit Polyclonal Anti-C14orf166B Antibody

See related secondary antibodies

Search for all "C14orf166B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Guinea Pig, Human C14orf166B

Product Description for C14orf166B

Rabbit anti Guinea Pig, Human C14orf166B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C14orf166B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C14orf166B
Presentation Purified
Reactivity GP, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0VAA2
Immunogen:
The immunogen for Anti-C14orf166B Antibody is: synthetic peptide directed towards the N-terminal region of Human C14orf166B. Synthetic peptide located within the following region: GMPPDEIEIEPVRQSSDKMLYCEAESPPTVEKVKPARENSETDLEIEDDE.
GeneID:
145497
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C14orf166B (1 products)

Catalog No. Species Pres. Purity   Source  

LRRC74A overexpression lysate

LRRC74A overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn